CHRM2, Mouse, Clone: 4B5, Abnova™

Catalog No.	Quantity
89-021-080	100 μg

Catalog No. 89-021-080 Supplier Abnova Corporation Supplier No. H00001129M01

Description

Mouse monoclonal antibody raised against a partial recombinant CHRM2.

The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine to these receptors and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The muscarinic cholinergic receptor 2 is involved in mediation of bradycardia and a decrease in cardiac contractility. Multiple alternatively spliced transcript variants have been described for this gene. [provided by RefSeq

Sequence: SDDGLEHNKIQNGKAPRDPVTENCVQGEEKESSNDSTSVSAVASNMRDDEITQDENTVSTSLGHSKDENSKQTCIRIGTKTPKSDSCTPTNTTVEVVGSS

Specifications

• Antigen: CHRM2
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4B5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CHRM2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CHRM2
• Gene Accession No.: NM_000739
• Gene Alias: FLJ43243/HM2/MGC120006/MGC120007
• Gene Symbols: CHRM2
• Host Species: Mouse
• Immunogen: CHRM2 (AAI06743.1, 251 a.a. ∼ 350 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1129
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ