Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

cholinergic receptor, muscarinic 3, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89004068 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-004-068 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-004-068 Supplier Abnova Corporation Supplier No. H00001131A01
Add to Cart
Add to Cart

Mouse polyclonal antibody raised against a partial recombinant CHRM3.

The muscarinic cholinergic receptors belong to a larger family of G protein-coupled receptors. The functional diversity of these receptors is defined by the binding of acetylcholine and includes cellular responses such as adenylate cyclase inhibition, phosphoinositide degeneration, and potassium channel mediation. Muscarinic receptors influence many effects of acetylcholine in the central and peripheral nervous system. The muscarinic cholinergic receptor 3 controls smooth muscle contraction and its stimulation causes secretion of glandular tissue. [provided by RefSeq

Sequence: MTLHNNSTTSPLFPNISSSWIHSPSDAGLPPGTVTHFGSYNVSRAAGNFSSPDGTTDDPLGGHTVWQ

Specifications

Antigen cholinergic receptor, muscarinic 3
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant CHRM3.
Formulation 50% glycerol
Gene CHRM3
Gene Accession No. NM_000740
Gene Alias HM3
Gene Symbols CHRM3
Host Species Mouse
Immunogen CHRM3 (NP_000731, 1 a.a. ∼ 67 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Research Discipline Membrane Receptors
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 1131
Target Species Human, Rat
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.