CHRNA4, Mouse, Clone: 4E3, Abnova™

Catalog No.	Quantity
89-021-082	100 μg

Catalog No. 89-021-082 Supplier Abnova Corporation Supplier No. H00001137M01

Description

Mouse monoclonal antibody raised against a partial recombinant CHRNA4.

This gene encodes a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast signal transmission at synapses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either nAChR beta-2 or nAChR beta-4 to form a functional receptor. Mutations in this gene cause nocturnal frontal lobe epilepsy type 1. Polymorphisms in this gene that provide protection against nicotine addiction have been described. [provided by RefSeq

Sequence: HVETRAHAEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWRPDIVLYNN

Specifications

• Antigen: CHRNA4
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4E3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CHRNA4.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CHRNA4
• Gene Accession No.: NM_000744
• Gene Alias: BFNC/EBN/EBN1/FLJ95812/NACHR/NACHRA4/NACRA4
• Gene Symbols: CHRNA4
• Host Species: Mouse
• Immunogen: CHRNA4 (NP_000735, 29 a.a. ∼ 128 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1137
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ