Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

cholinergic receptor, nicotinic, alpha 5, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant CHRNA5.

Manufacturer:  Abnova Corporation H00001138A01

Catalog No. 89-004-069


Add to cart

Description

Description

Nicotinic acetylcholine receptors (nAChRs), such as CHRNA5, are members of a superfamily of ligand-gated ion channels that mediate fast signal transmission at synapses. The nAChRs are thought to be (hetero)pentamers composed of homologous subunits. See MIM 118508 for additional background information on AChRs.[supplied by OMIM

Sequence: SEPSSIAKHEDSLLKDLFQDYERWVRPVEHLNDKIKIKFGLAISQLVDVDEKNQLMTTNVWLKQEWIDVKLRWNPDDYGGIKVIRVPSDSVWTP
Specifications

Specifications

cholinergic receptor, nicotinic, alpha 5
Unconjugated
50% glycerol
NM_000745
LNCR2
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
1138
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant CHRNA5.
CHRNA5
Serum
CHRNA5
CHRNA5 (NP_000736, 38 a.a. ~ 131 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit