CHRNE, Mouse, Clone: 1H5, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CHRNE.

Supplier:  Abnova Corporation H00001145M02

Catalog No. 89-123-145

Description

Acetylcholine receptors at mature mammalian neuromuscular junctions are pentameric protein complexes composed of four subunits in the ratio of two alpha subunits to one beta, one epsilon, and one delta subunit. The acetylcholine receptor changes subunit composition shortly after birth when the epsilon subunit replaces the gamma subunit seen in embryonic receptors. Mutations in the epsilon subunit are associated with congenital myasthenic syndrome. [provided by RefSeq

Sequence: KNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLISLNEKEETLTTSVWIGIDWQDYRLNYSKDDFGGIETLRVPSELVWLPEIVLENNIDGQFGVAYDANVLV

Specifications

• Antigen: CHRNE
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_000080
• Gene Symbols: CHRNE
• Immunogen: CHRNE (NP_000071, 21 a.a. ∼ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody
• Isotype: IgG3 κ

• Applications: ELISA, Western Blot
• Clone: 1H5
• Description: Mouse monoclonal antibody raised against a partial recombinant CHRNE.
• Gene: CHRNE
• Gene Alias: ACHRE/CMS1D/CMS1E/CMS2A/FCCMS/SCCMS
• Host Species: Mouse
• Purification Method: Affinity chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 1145
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid