CHRNE, Mouse, Clone: 1H5, Abnova™

Catalog No.	Quantity
89-123-145	100 μg

Catalog No. 89-123-145 Supplier Abnova Corporation Supplier No. H00001145M02

Description

Mouse monoclonal antibody raised against a partial recombinant CHRNE.

Acetylcholine receptors at mature mammalian neuromuscular junctions are pentameric protein complexes composed of four subunits in the ratio of two alpha subunits to one beta, one epsilon, and one delta subunit. The acetylcholine receptor changes subunit composition shortly after birth when the epsilon subunit replaces the gamma subunit seen in embryonic receptors. Mutations in the epsilon subunit are associated with congenital myasthenic syndrome. [provided by RefSeq

Sequence: KNEELRLYHHLFNNYDPGSRPVREPEDTVTISLKVTLTNLISLNEKEETLTTSVWIGIDWQDYRLNYSKDDFGGIETLRVPSELVWLPEIVLENNIDGQFGVAYDANVLV

Specifications

• Antigen: CHRNE
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1H5
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CHRNE.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CHRNE
• Gene Accession No.: NM_000080
• Gene Alias: ACHRE/CMS1D/CMS1E/CMS2A/FCCMS/SCCMS
• Gene Symbols: CHRNE
• Host Species: Mouse
• Immunogen: CHRNE (NP_000071, 21 a.a. ∼ 130 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1145
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG3 κ