Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant CHST2.

Manufacturer:  Abnova Corporation H00009435A01

Catalog No. 89-004-436


Add to cart

Description

Description

N-acetylglucosamine-6-O-sulfotransferases, such as CHST2, catalyze the transfer of sulfate from 3-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS) to position 6 of a nonreducing N-acetylglucosamine (GlcNAc) residue (Uchimura et al., 1998 [PubMed 9722682]).[supplied by OMIM

Sequence: DPVKTLRRVYDFVGLLVSPEMEQFALNMTSGSGSSSKPFVVSARNATQAANAWRTALTFQQIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL
Specifications

Specifications

carbohydrate (N-acetylglucosamine-6-O) sulfotransferase 2
Unconjugated
50% glycerol
NM_004267
C6ST|GST2
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
9435
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant CHST2.
CHST2
Serum
CHST2
CHST2 (NP_004258, 431 a.a. ~ 530 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit