conserved helix-loop-helix ubiquitous kinase, Mouse, Clone: 2G4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CHUK.

Supplier:  Abnova Corporation H00001147M04

Catalog No. 89-000-575

Description

This gene encodes a member of the serine/threonine protein kinase family. The encoded protein, a component of a cytokine-activated protein complex that is an inhibitor of the essential transcription factor NF-kappa-B complex, phosphorylates sites that trigger the degradation of the inhibitor via the ubiquination pathway, thereby activating the transcription factor. [provided by RefSeq

Sequence: RQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMNLDWSWLTE

Specifications

• Antigen: conserved helix-loop-helix ubiquitous kinase
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_001278
• Gene Symbols: CHUK
• Immunogen: CHUK (NP_001269, 646 a.a. ∼ 745 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Kinases
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), In situ PLA, Western Blot
• Clone: 2G4
• Description: Mouse monoclonal antibody raised against a partial recombinant CHUK.
• Gene: CHUK
• Gene Alias: IKBKA/IKK-alpha/IKK1/IKKA/NFKBIKA/TCF16
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 1147
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG1 κ