Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CHUK, Mouse, Clone: 4D11, Abnova™

Catalog No. 89021087 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-021-087 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-021-087 Supplier Abnova Corporation Supplier No. H00001147M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant CHUK.

This gene encodes a member of the serine/threonine protein kinase family. The encoded protein, a component of a cytokine-activated protein complex that is an inhibitor of the essential transcription factor NF-kappa-B complex, phosphorylates sites that trigger the degradation of the inhibitor via the ubiquination pathway, thereby activating the transcription factor. [provided by RefSeq

Sequence: RQKEIWHLLKIACTQSSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHLSTIIHEANEEQGNSMMNLDWSWLTE

Specifications

Antigen CHUK
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 4D11
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant CHUK.
Formulation PBS with no preservative; pH 7.4
Gene CHUK
Gene Accession No. NM_001278
Gene Alias IKBKA/IKK-alpha/IKK1/IKKA/NFKBIKA/TCF16
Gene Symbols CHUK
Host Species Mouse
Immunogen CHUK (NP_001269, 646 a.a. ∼ 745 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1147
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.