Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

cirrhosis, autosomal recessive 1A (cirhin), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant CIRH1A.

Manufacturer:  Abnova Corporation H00084916A01

Catalog No. 89-004-748


Add to cart

Description

Description

This gene encodes a WD40-repeat-containing protein that is localized to the nucleolus. Mutation of this gene causes North American Indian childhood cirrhosis, a severe intrahepatic cholestasis that results in transient neonatal jaundice, and progresses to periportal fibrosis and cirrhosis in childhood and adolescence. [provided by RefSeq

Sequence: SFHPKRPMHILLHDAYMFCIIDKSLPLPNDKTLLYNPFPPTNESDVIRRRTAHAFKISKIYKPLLFMDLLDERTLVAVERPLDDIIAQLPPPIKKKKFGT
Specifications

Specifications

cirrhosis, autosomal recessive 1A (cirhin)
Unconjugated
50% glycerol
NM_032830
CIRHIN|FLJ14728|FLJ17146|KIAA1988|NAIC|TEX292
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
84916
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant CIRH1A.
CIRH1A
Serum
CIRH1A
CIRH1A (NP_116219, 587 a.a. ~ 686 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit