Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1, Mouse, Clone: 6C1, Abnova™

Catalog No. 89000812 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-000-812 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-000-812 Supplier Abnova Corporation Supplier No. H00004435M02
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant CITED1.

This gene encodes a member of the CREB-binding protein/p300-interacting transactivator with Asp/Glu-rich C-terminal domain (CITED) family of proteins. The encoded protein, also known as melanocyte-specific gene 1, may function as a transcriptional coactivator and may play a role in pigmentation of melanocytes. Alternatively spliced transcript variants have been described. [provided by RefSeq

Sequence: SMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC

Specifications

Antigen Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 6C1
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant CITED1.
Formulation PBS with no preservative; pH 7.4
Gene CITED1
Gene Accession No. NM_004143
Gene Alias MSG1
Gene Symbols CITED1
Host Species Mouse
Immunogen CITED1 (NP_004134, 94 a.a. ∼ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Transcription Regulation
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 4435
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.