Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1, Mouse, Clone: 6C1, Abnova™

Catalog No.	Quantity
89-000-812	100 μg

Catalog No. 89-000-812 Supplier Abnova Corporation Supplier No. H00004435M02

Description

Mouse monoclonal antibody raised against a partial recombinant CITED1.

This gene encodes a member of the CREB-binding protein/p300-interacting transactivator with Asp/Glu-rich C-terminal domain (CITED) family of proteins. The encoded protein, also known as melanocyte-specific gene 1, may function as a transcriptional coactivator and may play a role in pigmentation of melanocytes. Alternatively spliced transcript variants have been described. [provided by RefSeq

Sequence: SMQLQKLNSQYQGMAAATPGQPGEAGPLQNWDFGAQAGGAESLSPSAGAQSPAIIDSDPVDEEVLMSLVVELGLDRANELPELWLGQNEFDFTADFPSSC

Specifications

• Antigen: Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 6C1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CITED1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CITED1
• Gene Accession No.: NM_004143
• Gene Alias: MSG1
• Gene Symbols: CITED1
• Host Species: Mouse
• Immunogen: CITED1 (NP_004134, 94 a.a. ∼ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Research Discipline: Transcription Regulation
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 4435
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2a κ