creatine kinase, mitochondrial 1B (B01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-005-140	50 μL

Catalog No. 89-005-140 Supplier Abnova Corporation Supplier No. H00001159B01

Description

Mouse polyclonal antibody raised against a full-length human CKMT1B protein.

Mitochondrial creatine (MtCK) kinase is responsible for the transfer of high energy phosphate from mitochondria to the cytosolic carrier, creatine. It belongs to the creatine kinase isoenzyme family. It exists as two isoenzymes, sarcomeric MtCK and ubiquitous MtCK, encoded by separate genes. Mitochondrial creatine kinase occurs in two different oligomeric forms: dimers and octamers, in contrast to the exclusively dimeric cytosolic creatine kinase isoenzymes. Many malignant cancers with poor prognosis have shown overexpression of ubiquitous mitochondrial creatine kinase; this may be related to high energy turnover and failure to eliminate cancer cells via apoptosis. Ubiquitous mitochondrial creatine kinase has 80% homology with the coding exons of sarcomeric mitochondrial creatine kinase. Two genes located near each other on chromosome 15 have been identified which encode identical mitochondrial creatine kinase proteins. [provided by RefSeq

Sequence: MAGPFSRLLSARPGLRLLALAGAGSLAAGFLLRPEPVRAASERRRLYPPSAEYPDLRKHNNCMASHLTPAVYARLCDKTTPTGWTLDQCIQTGVDNPGHPFIKTVGMVAGDEETYEVFADLFDPVIQERHNGYDPRTMKHTTDLDASKIRSGYFDERYVLSSRVRTGRSIRGLSLPPACTRAERREVERVVVDALSGLKGDLAGRYYRLSEMTEAEQQQLIDDHFLFDKPVSPLLTAAGMARDWPDARGIWHNNEKSFLIWVNEEDHTRVISMEKGGNMKRVFERFCRGLKEVERLIQERGWEFMWNERLGYILTCPSNLGTGLRAGVHIKLPLLSKDSRFPKILENLRLQKRGTGGVDTAATGGVFDISNLDRLGKSEVELVQLVIDGVNYLIDCERRLERGQDIRIPTPVIHTKH

Specifications

• Antigen: creatine kinase, mitochondrial 1B
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human CKMT1B protein.
• Formulation: No additive
• Gene: CKMT1B
• Gene Accession No.: NM_020990
• Gene Alias: CKMT/CKMT1/UMTCK
• Gene Symbols: CKMT1B
• Host Species: Mouse
• Immunogen: CKMT1B (NP_066270, 1 a.a. ∼ 417 a.a) full-length human protein.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Stem Cell Biology
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 1159
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum