CDC28 protein kinase regulatory subunit 2, Mouse, Clone: 2G12-2A5, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant CKS2.

Supplier:  Abnova Corporation H00001164M02

Catalog No. 89-000-577

Description

CKS2 protein binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. The CKS2 mRNA is found to be expressed in different patterns through the cell cycle in HeLa cells, which reflects specialized role for the encoded protein. [provided by RefSeq

Sequence: MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFRRPLPKDQQK

Specifications

• Antigen: CDC28 protein kinase regulatory subunit 2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC006458
• Gene Symbols: CKS2
• Immunogen: CKS2 (AAH06458, 1 a.a. ∼ 79 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Research Discipline: Cell Cycle
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 2G12-2A5
• Description: Mouse monoclonal antibody raised against a full length recombinant CKS2.
• Gene: CKS2
• Gene Alias: CKSHS2
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 1164
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2b κ