CLCA1, Mouse, Clone: 1C4, Abnova™

Catalog No.	Quantity
89-021-102	100 μg

Catalog No. 89-021-102 Supplier Abnova Corporation Supplier No. H00001179M02

Description

Mouse monoclonal antibody raised against a partial recombinant CLCA1.

This gene encodes a member of the calcium sensitive chloride conductance protein family. To date, all members of this gene family map to the same region on chromosome 1p31-p22 and share a high degree of homology in size, sequence, and predicted structure, but differ significantly in their tissue distributions. The encoded protein is expressed as a precursor protein that is processed into two cell-surface-associated subunits, although the site at which the precursor is cleaved has not been precisely determined. The encoded protein may be involved in mediating calcium-activated chloride conductance in the intestine. [provided by RefSeq

Sequence: ALGGVNAARRRVIPQQSGALYIPGWIENDEIQWNPPRPEINKDDVQHKQVCFSRTSSGGSFVASDVPNAPIPDLFPPGQITDLKAEIHGGSLINLTWTAP

Specifications

• Antigen: CLCA1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 1C4
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CLCA1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CLCA1
• Gene Accession No.: NM_001285
• Gene Alias: CACC/CACC1/CLCRG1/FLJ95147/GOB5
• Gene Symbols: CLCA1
• Host Species: Mouse
• Immunogen: CLCA1 (NP_001276, 677 a.a. ∼ 776 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1179
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ