chloride channel 7, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-073	50 μL

Catalog No. 89-004-073 Supplier Abnova Corporation Supplier No. H00001186A01

Description

Mouse polyclonal antibody raised against a partial recombinant CLCN7.

The product of this gene belongs to the CLC chloride channel family of proteins. Chloride channels play important roles in the plasma membrane and in intracellular organelles. This gene encodes chloride channel 7. Defects in this gene are the cause of osteopetrosis autosomal recessive type 4 (OPTB4), also called infantile malignant osteopetrosis type 2 as well as the cause of autosomal dominant osteopetrosis type 2 (OPTA2), also called autosomal dominant Albers-Schonberg disease or marble disease autosoml dominant. Osteopetrosis is a rare genetic disease characterized by abnormally dense bone, due to defective resorption of immature bone. OPTA2 is the most common form of osteopetrosis, occurring in adolescence or adulthood. [provided by RefSeq

Sequence: LRLKDFRDAYPRFPPIQSIHVSQDERECTMDLSEFMNPSPYTVPQEASLPRVFKLFRALGLRHLVVVDNRNQVVGLVTRKDLARYRLGKRGLEELSLAQT

Specifications

• Antigen: chloride channel 7
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant CLCN7.
• Formulation: 50% glycerol
• Gene: CLCN7
• Gene Accession No.: NM_001287
• Gene Alias: CLC-7/CLC7/FLJ26686/FLJ39644/FLJ46423/OPTA2/OPTB4
• Gene Symbols: CLCN7
• Host Species: Mouse
• Immunogen: CLCN7 (NP_001278, 706 a.a. ∼ 805 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 1186
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum