claudin 10, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length human CLDN10 protein.

Supplier:  Abnova Corporation H00009071B01

Catalog No. 89-006-700

Description

This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq

Sequence: MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKACVTDSTGVSNCKDFPSMLALDGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLAGIVFILSGLCSMTGCSLYANKITTEFFDPLFVEQKYELGAALFIGWAGASLCIIGGVIFCFSISDNNKTPRYTYNGATSVMSSRTKYHGGEDFKTTNPSKQFDKNAYV

Specifications

• Antigen: claudin 10
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a full-length human CLDN10 protein.
• Gene: CLDN10
• Gene Alias: CPETRL3/OSP-L
• Host Species: Mouse
• Quantity: 50 μL
• Research Discipline: Cell Adhesion
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: No additive
• Gene Accession No.: BC010920
• Gene Symbols: CLDN10
• Immunogen: CLDN10 (AAH10920, 1 a.a. ∼ 228 a.a) full-length human protein.
• Regulatory Status: RUO
• Whole Molecule: Yes
• Gene ID (Entrez): 9071
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.