Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89021148

CLDN4, Mouse, Clone: 4A4, Abnova™

Catalog No. 89021148 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
200 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-021-148 200 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-021-148 Supplier Abnova Corporation Supplier No. H00001364M01A
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant CLDN4.

This gene encodes an integral membrane protein, which belongs to the claudin family. The protein is a component of tight junction strands and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems. [provided by RefSeq

Sequence: MWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQ

Specifications

Antigen CLDN4
Applications ELISA, Western Blot
Classification Monoclonal
Clone 4A4
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant CLDN4.
Formulation ascites with no preservative
Gene CLDN4
Gene Accession No. NM_001305
Gene Alias CPE-R/CPER/CPETR/CPETR1/WBSCR8/hCPE-R
Gene Symbols CLDN4
Host Species Mouse
Immunogen CLDN4 (NP_001296, 29 a.a. ∼ 78 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Quantity 200 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1364
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Ascites
Isotype IgG3 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.