Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CLDN4, Mouse, Clone: 4A4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CLDN4.

Manufacturer:  Abnova Corporation H00001364M01A

Catalog No. 89-021-148


  Check Availability
Add to cart

Specifications

Description

This gene encodes an integral membrane protein, which belongs to the claudin family. The protein is a component of tight junction strands and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems. [provided by RefSeq

Sequence: MWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQ
Description & Specifications

Specifications

CLDN4
4A4
Human
Ascites
CLDN4
CPE-R, CPER, CPETR, CPETR1, WBSCR8, hCPE-R
Murine
IgG3, κ
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA,Western Blot
Unlabeled
claudin 4
In ascites fluid
NM_001305
CLDN4
CLDN4 (NP_001296, 29 a.a. ∽79 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa.
200μL
Human
Primary
1364
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit