CLDN4, Mouse, Clone: 4A4, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CLDN4.

Manufacturer: Abnova Corporation H00001364M01A

Catalog No. 89-021-148

  Check Availability
Add to Cart

    Specifications

    Antigen CLDN4
    Applications Enzyme Linked Immunosorbent Assay,Western Blotting
    Clone 4A4
    Conjugate Unlabeled
    Cross Reactivity Human
    Description claudin 4
    Format Ascites
    Formulation In ascites fluid
    Gene CLDN4
    Gene Accession No. NM_001305
    Gene Alias CPE-R, CPER, CPETR, CPETR1, WBSCR8, hCPE-R
    Gene Symbols CLDN4
    Host Species Mouse
    Immunogen CLDN4 (NP_001296, 29 a.a. ∽79 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa.
    Isotype IgG3, κ
    Quantity 200μL
    Regulatory Status RUO
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Monoclonal
    Gene ID (Entrez) 1364

    This gene encodes an integral membrane protein, which belongs to the claudin family. The protein is a component of tight junction strands and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems. [provided by RefSeq

    Sequence: MWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQ

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit