C-type lectin domain family 2, member D, Rabbit, Purified MaxPab™ Polyclonal Antibody, Abnova™

Rabbit polyclonal antibody raised against a full-length human CLEC2D protein.

Supplier:  Abnova Corporation H00029121D01P

Catalog No. 89-018-150

Description

This gene encodes a member of the natural killer cell receptor C-type lectin family. The encoded protein inhibits osteoclast formation and contains a transmembrane domain near the N-terminus as well as the C-type lectin-like extracellular domain. Several alternatively spliced transcript variants have been identified, but the full-length nature of every transcript has not been defined. [provided by RefSeq

Sequence: MHDSNNVEKDITPSELPANPGCLHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQFPILGAGECAYLNDKGASSARHYTERKWICSKSDIHV

Specifications

• Antigen: C-type lectin domain family 2, member D
• Classification: Polyclonal
• Description: Rabbit polyclonal antibody raised against a full-length human CLEC2D protein.
• Gene: CLEC2D
• Gene Alias: CLAX/LLT1/OCIL
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse
• Product Type: Antibody

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: NM_013269
• Gene Symbols: CLEC2D
• Immunogen: CLEC2D (NP_037401.1, 1 a.a. ∼ 191 a.a) full-length human protein.
• Quantity: 100 μg
• Research Discipline: Membrane Receptors
• Gene ID (Entrez): 29121
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG