C-type lectin domain family 4, member D, Mouse, Purified MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-016-642	50 μg

Catalog No. 89-016-642 Supplier Abnova Corporation Supplier No. H00338339B01P

Description

Mouse polyclonal antibody raised against a full-length human CLEC4D protein.

This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. This gene is closely linked to other CTL/CTLD superfamily members on chromosome 12p13 in the natural killer gene complex region. [provided by RefSeq

Sequence: MGLEKPQSKLEGGMHPQLIPSVIAVVFILLLSVCFIASCLVTHHNFSRCKRGTGVHKLEHHAKLKCIKEKSELKSAEGSTWNCCPIDWRAFQSNCYFPLTDNKTWAESERNCSGMGAHLMTISTEAEQNFIIQFLDRRLSYFLGLRDENAKGQWRWVDQTPFNPRRVFWHKNEPDNSQGENCVVLVYNQDKWAWNDVPCNFEASRICKIPGTTLN

Specifications

• Antigen: C-type lectin domain family 4, member D
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human CLEC4D protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CLEC4D
• Gene Accession No.: NM_080387.4
• Gene Alias: CLEC-6/CLEC6/CLECSF8/MCL/MGC40078/MPCL
• Gene Symbols: CLEC4D
• Host Species: Mouse
• Immunogen: CLEC4D (NP_525126.2, 1 a.a. ∼ 215 a.a) full-length human protein.
• Purification Method: Affinity Purified
• Quantity: 50 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 338339
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG