CLIC1, Mouse, Clone: 2D4, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant CLIC1.

Manufacturer:  Abnova Corporation H00001192M01

Catalog No. 89-021-107

Description

Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity. [provided by RefSeq

Sequence: MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSSPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK

See Product Certificates

Specifications

• Antigen: CLIC1
• Clone: 2D4
• Description: chloride intracellular channel 1
• Gene: CLIC1
• Format: Liquid
• Gene Symbols: CLIC1
• Immunogen: CLIC1 (AAH64527, 1 a.a. ∽242 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kDa
• Quantity: 100μg
• Storage Requirements: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Monoclonal or Polyclonal: Monoclonal
• Target Species: Human

• Applications: ELISA,Immunofluorescence,Immunohistochemistry,Sandwich ELISA,Western Blot
• Conjugate: Unlabeled
• Formulation: In 1X PBS, pH 7.4
• Gene Accession No.: BC064527
• Gene Alias: G6, NCC27
• Host Species: Murine
• Isotype: IgG1, κ
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1192