Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CLIC1, Mouse, Clone: 2D4, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant CLIC1.

Manufacturer:  Abnova Corporation H00001192M01

Catalog No. 89-021-107


  Check Availability
Add to cart

Specifications

Description

Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity. [provided by RefSeq

Sequence: MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSSPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK
Description & Specifications

Specifications

CLIC1
2D4
chloride intracellular channel 1
CLIC1
Liquid
CLIC1
CLIC1 (AAH64527, 1 a.a. ∽242 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kDa
100μg
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA,Immunofluorescence,Immunohistochemistry,Sandwich ELISA,Western Blot
Unlabeled
In 1X PBS, pH 7.4
BC064527
G6, NCC27
Murine
IgG1, κ
RUO
Primary
1192
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit