CLIC1, Mouse, Clone: 2D4, Abnova™

Mouse monoclonal antibody raised against a full-length recombinant CLIC1.

Manufacturer: Abnova Corporation H00001192M01

Catalog No. 89-021-107

  Check Availability
Add to Cart

    Specifications

    Antigen CLIC1
    Applications Enzyme Linked Immunosorbent Assay,Immunofluorescence,Immunohistochemistry,Sandwich ELISA,Western Blotting
    Clone 2D4
    Conjugate Unlabeled
    Cross Reactivity Human
    Description chloride intracellular channel 1
    Format Liquid
    Formulation In 1X PBS, pH 7.4
    Gene CLIC1
    Gene Accession No. BC064527
    Gene Alias G6, NCC27
    Gene Symbols CLIC1
    Host Species Mouse
    Immunogen CLIC1 (AAH64527, 1 a.a. ∽242 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kDa
    Isotype IgG1, κ
    Quantity 100μg
    Regulatory Status RUO
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Monoclonal
    Gene ID (Entrez) 1192

    Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 1 is a member of the p64 family; the protein localizes principally to the cell nucleus and exhibits both nuclear and plasma membrane chloride ion channel activity. [provided by RefSeq

    Sequence: MAEEQPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPRYPKLAALNPESNTAGLDIFAKFSAYIKNSSPALNDNLEKGLLKALKVLDNYLTSPLPEEVDETSAEDEGVSQRKFLDGNELTLADCNLLPKLHIVQVVCKKYRGFTIPEAFRGVHRYLSNAYAREEFASTCPDDEEIELAYEQVAKALK

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit