CLK3, Mouse, Clone: 7D6, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CLK3.

Manufacturer: Abnova Corporation H00001198M07A

Catalog No. 89-021-116

  Check Availability
Add to Cart

    Specifications

    Antigen CLK3
    Applications Enzyme Linked Immunosorbent Assay,Immunofluorescence,Immunohistochemistry,Western Blotting
    Clone 7D6
    Conjugate Unlabeled
    Cross Reactivity Human
    Description CDC-like kinase 3
    Format Ascites
    Formulation In ascites fluid
    Gene CLK3
    Gene Accession No. BC002555
    Gene Alias FLJ22858, PHCLK3, PHCLK3/152
    Gene Symbols CLK3
    Host Species Mouse
    Immunogen CLK3 (AAH02555, 36 a.a. ∽136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa.
    Isotype IgG2b, κ
    Quantity 200μL
    Regulatory Status RUO
    Species Reactivity Human
    Storage Requirements Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
    Primary or Secondary Primary
    Monoclonal or Polyclonal Monoclonal
    Gene ID (Entrez) 1198

    This gene encodes a protein belonging to the serine/threonine type protein kinase family. This protein is a nuclear dual-specificity kinase that regulates the intranuclear distribution of the serine/arginine-rich (SR) family of splicing factors. Two transcript variants encoding different isoforms have been found for this gene. Related pseudogenes are located on chromosomes 1 and 9. [provided by RefSeq

    Sequence: YPSRREPPPRRSRSRSHDRLPYQRRYRERRDSDTYRCEERSPSFGEDYYGPSRSRHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSV

  • Description & Specifications

Related Products


Product Content Feedback

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit