Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CLK3, Mouse, Clone: 7D6, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CLK3.

Manufacturer:  Abnova Corporation H00001198M07

Catalog No. 89-021-115


  Check Availability
Add to cart

Specifications

Description

This gene encodes a protein belonging to the serine/threonine type protein kinase family. This protein is a nuclear dual-specificity kinase that regulates the intranuclear distribution of the serine/arginine-rich (SR) family of splicing factors. Two transcript variants encoding different isoforms have been found for this gene. Related pseudogenes are located on chromosomes 1 and 9. [provided by RefSeq

Sequence: YPSRREPPPRRSRSRSHDRLPYQRRYRERRDSDTYRCEERSPSFGEDYYGPSRSRHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSV
Description & Specifications

Specifications

CLK3
7D6
Human
Liquid
CLK3
FLJ22858, PHCLK3, PHCLK3/152
Murine
IgG2b, κ
RUO
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Monoclonal
Human
ELISA,Immunofluorescence,Immunohistochemistry,Western Blot
Unlabeled
CDC-like kinase 3
In 1X PBS, pH 7.4
BC002555
CLK3
CLK3 (AAH02555, 36 a.a. ∽136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26kDa.
100μg
Human
Primary
1198
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit