Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CLK3 (M07), Mouse anti-Human, Clone: 7D6, Abnova™

Catalog No. 89021115 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-021-115 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-021-115 Supplier Abnova Corporation Supplier No. H00001198M07
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant CLK3.

This gene encodes a protein belonging to the serine/threonine type protein kinase family. This protein is a nuclear dual-specificity kinase that regulates the intranuclear distribution of the serine/arginine-rich (SR) family of splicing factors. Two transcript variants encoding different isoforms have been found for this gene. Related pseudogenes are located on chromosomes 1 and 9. [provided by RefSeq

Sequence: YPSRREPPPRRSRSRSHDRLPYQRRYRERRDSDTYRCEERSPSFGEDYYGPSRSRHRRRSRERGPYRTRKHAHHCHKRRTRSCSSASSRSQQSSKRSSRSV

Specifications

Antigen CLK3
Applications ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
Classification Monoclonal
Clone 7D6
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant CLK3.
Formulation PBS with no preservative; pH 7.4
Gene CLK3
Gene Accession No. BC002555
Gene Alias FLJ22858/PHCLK3/PHCLK3/152
Gene Symbols CLK3
Host Species Mouse
Immunogen CLK3 (AAH02555, 36 a.a. ∼ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1198
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2b κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.