Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CLTC, Mouse, Clone: 2E5, Abnova™

Catalog No. 89021122 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-021-122 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-021-122 Supplier Abnova Corporation Supplier No. H00001213M05
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant CLTC.

Clathrin is a major protein component of the cytoplasmic face of intracellular organelles, called coated vesicles and coated pits. These specialized organelles are involved in the intracellular trafficking of receptors and endocytosis of a variety of macromolecules. The basic subunit of the clathrin coat is composed of three heavy chains and three light chains. [provided by RefSeq

Sequence: EVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITN

Specifications

Antigen CLTC
Applications ELISA, In situ PLA, Western Blot
Classification Monoclonal
Clone 2E5
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant CLTC.
Formulation PBS with no preservative; pH 7.4
Gene CLTC
Gene Accession No. NM_004859
Gene Alias CHC/CHC17/CLH-17/CLTCL2/Hc/KIAA0034
Gene Symbols CLTC
Host Species Mouse
Immunogen CLTC (NP_004850, 232 a.a. ∼ 340 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1213
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.