clathrin, heavy chain (Hc), Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant CLTC.

Supplier:  Abnova Corporation H00001213A01

Catalog No. 89-004-074

Description

Clathrin is a major protein component of the cytoplasmic face of intracellular organelles, called coated vesicles and coated pits. These specialized organelles are involved in the intracellular trafficking of receptors and endocytosis of a variety of macromolecules. The basic subunit of the clathrin coat is composed of three heavy chains and three light chains. [provided by RefSeq

Sequence: EVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITN

Specifications

• Antigen: clathrin, heavy chain (Hc)
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant CLTC.
• Gene: CLTC
• Gene Alias: CHC/CHC17/CLH-17/CLTCL2/Hc/KIAA0034
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 1213
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_004859
• Gene Symbols: CLTC
• Immunogen: CLTC (NP_004850, 232 a.a. ∼ 340 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum