cytidine monophosphate (UMP-CMP) kinase 1, cytosolic (A01), Mouse anti-Human, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant CMPK.

Supplier:  Abnova Corporation H00051727A01

Catalog No. 89-004-639

Description

Uridine monophosphate (UMP)/cytidine monophosphate (CMP) kinase (EC 2.7.4.4) catalyzes the phosphoryl transfer from ATP to UMP, CMP, and deoxy-CMP (dCMP), resulting in the formation of ADP and the corresponding nucleoside diphosphate. These nucleoside diphosphates are required for cellular nucleic acid synthesis (Liou et al., 2002 [PubMed 11912132]).[supplied by OMIM

Sequence: DERKNPDSQYGELIEKYIKEGKIVPVEITISLLKREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRESLE

Specifications

• Antigen: cytidine monophosphate (UMP-CMP) kinase 1, cytosolic
• Classification: Polyclonal
• Description: Mouse polyclonal antibody raised against a partial recombinant CMPK.
• Gene: CMPK1
• Gene Alias: CMK/CMPK/UMK/UMP-CMPK/UMPK
• Host Species: Mouse
• Quantity: 50 μL
• Whole Molecule: Yes
• Gene ID (Entrez): 51727
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.

• Applications: ELISA, Western Blot
• Conjugate: Unconjugated
• Formulation: 50% glycerol
• Gene Accession No.: NM_016308
• Gene Symbols: CMPK1
• Immunogen: CMPK (NP_057392, 72 a.a. ∼ 181 a.a) partial recombinant protein with GST tag.
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Serum