Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CNDP dipeptidase 2 (metallopeptidase M20 family), Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89004673 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-004-673 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-004-673 Supplier Abnova Corporation Supplier No. H00055748A01
Add to Cart
Add to Cart

Mouse polyclonal antibody raised against a partial recombinant CNDP2.

CNDP2, also known as tissue carnosinase and peptidase A (EC 3.4.13.18), is a nonspecific dipeptidase rather than a selective carnosinase (Teufel et al., 2003 [PubMed 12473676]).[supplied by OMIM

Sequence: VCISDNYWLGKKKPCITYGLRGICYFFIEVECSNKDLHSGVYGGSVHEAMTDLILLMGSLVDKRGNILIPGINEAVAAVTEEEHKLYDDIDFDIEEFAKDVGAQILLHSH

Specifications

Antigen CNDP dipeptidase 2 (metallopeptidase M20 family)
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant CNDP2.
Formulation 50% glycerol
Gene CNDP2
Gene Accession No. NM_018235
Gene Alias CN2/CPGL/FLJ10830/HsT2298/PEPA
Gene Symbols CNDP2
Host Species Mouse
Immunogen CNDP2 (NP_060705, 191 a.a. ∼ 300 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 55748
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.