cannabinoid receptor 1 (brain), Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-076	50 μL

Catalog No. 89-004-076 Supplier Abnova Corporation Supplier No. H00001268A01

Description

Mouse polyclonal antibody raised against a partial recombinant CNR1.

This gene encodes one of two cannabinoid receptors. The cannabinoids, principally delta-9-tetrahydrocannabinol and synthetic analogs, are psychoactive ingredients of marijuana. The cannabinoid receptors are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family, which inhibit adenylate cyclase activity in a dose-dependent, stereoselective and pertussis toxin-sensitive manner. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. Multiple transcript variants encoding two different protein isoforms have been described for this gene. [provided by RefSeq

Sequence: MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMV

Specifications

• Antigen: cannabinoid receptor 1 (brain)
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant CNR1.
• Formulation: 50% glycerol
• Gene: CNR1
• Gene Accession No.: NM_016083
• Gene Alias: CANN6/CB-R/CB1/CB1A/CB1K5/CB1R/CNR
• Gene Symbols: CNR1
• Host Species: Mouse
• Immunogen: CNR1 (NP_057167, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Membrane Receptors
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 1268
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum