CNR1, Mouse, Clone: 2F9, Abnova™

Catalog No.	Quantity
89-021-127	100 μg

Catalog No. 89-021-127 Supplier Abnova Corporation Supplier No. H00001268M01

Description

Mouse monoclonal antibody raised against a partial recombinant CNR1.

This gene encodes one of two cannabinoid receptors. The cannabinoids, principally delta-9-tetrahydrocannabinol and synthetic analogs, are psychoactive ingredients of marijuana. The cannabinoid receptors are members of the guanine-nucleotide-binding protein (G-protein) coupled receptor family, which inhibit adenylate cyclase activity in a dose-dependent, stereoselective and pertussis toxin-sensitive manner. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. Multiple transcript variants encoding two different protein isoforms have been described for this gene. [provided by RefSeq

Sequence: MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMV

Specifications

• Antigen: CNR1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2F9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CNR1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CNR1
• Gene Accession No.: NM_016083
• Gene Alias: CANN6/CB-R/CB1/CB1A/CB1K5/CB1R/CNR
• Gene Symbols: CNR1
• Host Species: Mouse
• Immunogen: CNR1 (NP_057167, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1268
• Target Species: Human, Rat
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2b κ