CNTF, Rabbit, MaxPab™ Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-002-885	100 μL

Catalog No. 89-002-885 Supplier Abnova Corporation Supplier No. H00001270D01

Description

Rabbit polyclonal antibody raised against a full-length human CNTF protein.

The protein encoded by this gene is a polypeptide hormone whose actions appear to be restricted to the nervous system where it promotes neurotransmitter synthesis and neurite outgrowth in certain neuronal populations. The protein is a potent survival factor for neurons and oligodendrocytes and may be relevant in reducing tissue destruction during inflammatory attacks. A mutation in this gene, which results in aberrant splicing, leads to ciliary neurotrophic factor deficiency, but this phenotype is not causally related to neurologic disease. A read-through transcript variant composed of ZFP91 and CNTF sequence has been identified, but it is thought to be noncoding. Read-through transcription of ZFP91 and CNTF has also been observed in mouse. [provided by RefSeq

Sequence: MAFTEHSPLTPHRRDLCSRSIWLARKIRSDLTALTESYVKHQGLNKNINLDSADGMPVASTDQWSELTEAERLQENLQAYRTFHVLLARLLEDQQVHFTPTEGDFHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNKKM

Specifications

• Antigen: CNTF
• Applications: Immunoprecipitation, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against a full-length human CNTF protein.
• Formulation: No additive
• Gene: CNTF
• Gene Accession No.: NM_000614
• Gene Alias: HCNTF
• Gene Symbols: CNTF
• Host Species: Rabbit
• Immunogen: CNTF (NP_000605.1, 1 a.a. ∼ 200 a.a) full-length human protein.
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1270
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid