contactin associated protein-like 4, Mouse, Clone: 5G1, Abnova™

Catalog No.	Quantity
89-001-558	200 μL

Catalog No. 89-001-558 Supplier Abnova Corporation Supplier No. H00085445M01A

Description

Mouse monoclonal antibody raised against a partial recombinant CNTNAP4.

This gene product belongs to the neurexin family, members of which function in the vertebrate nervous system as cell adhesion molecules and receptors. This protein, like other neurexin proteins, contains epidermal growth factor repeats and laminin G domains. In addition, it includes an F5/8 type C domain, discoidin/neuropilin- and fibrinogen-like domains, and thrombospondin N-terminal-like domains. Alternative splicing results in two transcript variants encoding different isoforms. [provided by RefSeq

Sequence: VLGRILEHSDVDQETALAGAQGFTGCLSAVQLSHVAPLKAALHPSHPDPVTVTGHVTESSCMAQPGTDATSRERTHSFADHSGTIDDREPLANAIKSDSA

Specifications

• Antigen: contactin associated protein-like 4
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 5G1
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CNTNAP4.
• Formulation: ascites with no preservative
• Gene: CNTNAP4
• Gene Accession No.: NM_033401
• Gene Alias: CASPR4/KIAA1763
• Gene Symbols: CNTNAP4
• Host Species: Mouse
• Immunogen: CNTNAP4 (NP_207837, 1145 a.a. ∼ 1244 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Research Discipline: Cell Adhesion
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 85445
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ