coilin, Mouse, Clone: 4B8, Abnova™

Catalog No.	Quantity
89-001-498	200 μL

Catalog No. 89-001-498 Supplier Abnova Corporation Supplier No. H00008161M05A

Description

Mouse monoclonal antibody raised against a partial recombinant COIL.

The protein encoded by this gene is an integral component of Cajal bodies (also called coiled bodies). Cajal bodies are nuclear suborganelles of varying number and composition that are involved in the post-transcriptional modification of small nuclear and small nucleolar RNAs. The N-terminus of the coilin protein directs its self-oligomerization while the C-terminus influences the number of nuclear bodies assembled per cell. Differential methylation and phosphorylation of coilin likely influences its localization among nuclear bodies and the composition and assembly of Cajal bodies. This gene has pseudogenes on chromosome 4 and chromosome 14. [provided by RefSeq

Sequence: IAFKLLELTSSYSPDVSDYKEGRILSHNPETQQVDIEILSSLPALREPGKFDLVYHNENGAEVVEYAVTQESKITVFWKELIDPRLIIESPSNTSSTEP

Specifications

• Antigen: coilin
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 4B8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant COIL.
• Formulation: ascites with no preservative
• Gene: COIL
• Gene Accession No.: NM_004645
• Gene Alias: CLN80/p80-coilin
• Gene Symbols: COIL
• Host Species: Mouse
• Immunogen: COIL (NP_004636, 477 a.a. ∼ 575 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 200 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 8161
• Target Species: Human, Mouse
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Ascites
• Isotype: IgM κ