catechol-O-methyltransferase, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-005-161	50 μL

Catalog No. 89-005-161 Supplier Abnova Corporation Supplier No. H00001312B01

Description

Mouse polyclonal antibody raised against a full-length human COMT protein.

Catechol-O-methyltransferase catalyzes the transfer of a methyl group from S-adenosylmethionine to catecholamines, including the neurotransmitters dopamine, epinephrine, and norepinephrine. This O-methylation results in one of the major degradative pathways of the catecholamine transmitters. In addition to its role in the metabolism of endogenous substances, COMT is important in the metabolism of catechol drugs used in the treatment of hypertension, asthma, and Parkinson disease. COMT is found in two forms in tissues, a soluble form (S-COMT) and a membrane-bound form (MB-COMT). The differences between S-COMT and MB-COMT reside within the N-termini. Several transcript variants are formed through the use of alternative translation initiation sites and promoters. [provided by RefSeq

Sequence: MGDTKEQRILNHVLQHAEPGNAQSVLEAIDTYCEQKEWAMNVGDKKGKIVDAVIQEHQPSVLLELGAYCGYSAVRMARLLSPGARLITIEINPDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDHWKDRYLPDTLLLEECGLLRKGTVLLADNVICPGAPDFLAHVRGSSCFECTHYQSFLEYREVVDGLEKAIYKGPGSEAGP

Specifications

• Antigen: catechol-O-methyltransferase
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a full-length human COMT protein.
• Formulation: No additive
• Gene: COMT
• Gene Accession No.: NM_007310.1
• Gene Symbols: COMT
• Host Species: Mouse
• Immunogen: COMT (NP_009294.1, 1 a.a. ∼ 221 a.a) full-length human protein.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Endocrine/Metabolism
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 1312
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum