coatomer protein complex, subunit beta 1, Mouse, Clone: 3E10, Abnova™

Catalog No.	Quantity
89-000-583	100 μg

Catalog No. 89-000-583 Supplier Abnova Corporation Supplier No. H00001315M08

Description

Mouse monoclonal antibody raised against a partial recombinant COPB.

This gene encodes a protein subunit of the coatomer complex associated with nonclathrin coated vesicles. The coatomer complex, also known as the coat protein complex 1, forms in the cytoplasm and is recruited to the Golgi by activated guanosine triphosphatases. Once at the Golgi membrane, the coatomer complex may assist in the movement of protein and lipid components back to the endoplasmic reticulum. Alternatively spliced transcript variants have been described. [provided by RefSeq

Sequence: TVNTNMVDLNDYLQHILKSTNMKCLTPEKALSGYCGFMAANLYARSIFGEDALANVSIEKPIHQGPDAAVTGHIRIRAKSQGMALSLGDKINLSQKKTSI

Specifications

• Antigen: coatomer protein complex, subunit beta 1
• Applications: ELISA
• Classification: Monoclonal
• Clone: 3E10
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant COPB.
• Formulation: PBS with no preservative; pH 7.4
• Gene: COPB1
• Gene Accession No.: NM_016451
• Gene Alias: COPB/DKFZp761K102/FLJ10341
• Gene Symbols: COPB1
• Host Species: Mouse
• Immunogen: COPB (NP_057535, 854 a.a. ∼ 953 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity Purified
• Quantity: 100 μg
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 1315
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Isotype: IgG2b κ