coatomer protein complex, subunit epsilon, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-543	50 μL

Catalog No. 89-004-543 Supplier Abnova Corporation Supplier No. H00011316A01

Description

Mouse polyclonal antibody raised against a partial recombinant COPE.

The product of this gene is an epsilon subunit of coatomer protein complex. Coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi nonclathrin-coated vesicles. It is required for budding from Golgi membranes, and is essential for the retrograde Golgi-to-ER transport of dilysine-tagged proteins. Coatomer complex consists of at least the alpha, beta, beta', gamma, delta, epsilon and zeta subunits. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq]

Sequence: KCSPTLLLLNGQAACHMAQGRWEAAEGLLQEALDKDSGYPETLVNLIVLSQHLGKPPEVTNRYLSQLKDAHRSHPFIKEYQAKENDFDRLVLQYAPSA

Specifications

• Antigen: coatomer protein complex, subunit epsilon
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant COPE.
• Formulation: 50% glycerol
• Gene: COPE
• Gene Accession No.: NM_007263
• Gene Alias: FLJ13241/epsilon-COP
• Gene Symbols: COPE
• Host Species: Mouse
• Immunogen: COPE (NP_009194, 211 a.a. ∼ 308 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 11316
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum