cytochrome c oxidase subunit IV isoform 1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-078	50 μL

Catalog No. 89-004-078 Supplier Abnova Corporation Supplier No. H00001327A01

Description

Mouse polyclonal antibody raised against a partial recombinant COX4I1.

Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradient across the inner mitochondrial membrane. The complex consists of 13 mitochondrial- and nuclear-encoded subunits. The mitochondrially-encoded subunits perform the electron transfer and proton pumping activities. The functions of the nuclear-encoded subunits are unknown but they may play a role in the regulation and assembly of the complex. This gene encodes the nuclear-encoded subunit IV isoform 1 of the human mitochondrial respiratory chain enzyme. It is located at the 3' of the NOC4 (neighbor of COX4) gene in a head-to-head orientation, and shares a promoter with it. [provided by RefSeq]

Sequence: MLATRVFSLVGKRAISTSVCVRAHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESF

Specifications

• Antigen: cytochrome c oxidase subunit IV isoform 1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant COX4I1.
• Formulation: 50% glycerol
• Gene: COX4I1
• Gene Accession No.: NM_001861
• Gene Alias: COX4/COXIV/MGC72016
• Gene Symbols: COX4I1
• Host Species: Mouse
• Immunogen: COX4I1 (NP_001852, 1 a.a. ∼ 90 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 1327
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum