Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89014342

cytochrome c oxidase subunit IV isoform 2 (lung), Mouse, Clone: 1F2, Abnova™

Catalog No. 89014342 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-014-342 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-014-342 Supplier Abnova Corporation Supplier No. H00084701M01
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant COX4I2.

Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes isoform 2 of subunit IV. Isoform 1 of subunit IV is encoded by a different gene, however, the two genes show a similar structural organization. Subunit IV is the largest nuclear encoded subunit which plays a pivotal role in COX regulation. [provided by RefSeq

Sequence: MHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCTELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSNEWKT

Specifications

Antigen cytochrome c oxidase subunit IV isoform 2 (lung)
Applications ELISA, Immunohistochemistry (PFA fixed), Immunoprecipitation, Western Blot
Classification Monoclonal
Clone 1F2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant COX4I2.
Formulation PBS with no preservative; pH 7.4
Gene COX4I2
Gene Accession No. NM_032609
Gene Alias COX4/COX4-2/COX4B/COX4L2/COXIV-2/dJ857M17.2
Gene Symbols COX4I2
Host Species Mouse
Immunogen COX4I2 (NP_115998, 21 a.a. ∼ 104 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 84701
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.