COX4I2, Rabbit, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-003-206	100 μg

Catalog No. 89-003-206 Supplier Abnova Corporation Supplier No. H00084701D01P

Description

Rabbit polyclonal antibody raised against a full-length human COX4I2 protein.

Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes isoform 2 of subunit IV. Isoform 1 of subunit IV is encoded by a different gene, however, the two genes show a similar structural organization. Subunit IV is the largest nuclear encoded subunit which plays a pivotal role in COX regulation. [provided by RefSeq

Sequence: MLPRAAWSLVLRKGGGGRRGMHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCTELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSNEWKTVMGCVFFFIGFAALVIWWQRVYVFPPKPITLTDERKAQQLQRMLDMKVNPVQGLASRWDYEKKQWKK

Specifications

• Antigen: COX4I2
• Applications: Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Rabbit polyclonal antibody raised against a full-length human COX4I2 protein.
• Formulation: PBS with no preservative; pH 7.4
• Gene: COX4I2
• Gene Accession No.: NM_032609.2
• Gene Alias: COX4/COX4-2/COX4B/COX4L2/COXIV-2/dJ857M17.2
• Gene Symbols: COX4I2
• Host Species: Rabbit
• Immunogen: COX4I2 (NP_115998.2, 1 a.a. ∼ 171 a.a) full-length human protein.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 84701
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Purified
• Isotype: IgG