COX6B1, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-003-253	50 μL

Catalog No. 89-003-253 Supplier Abnova Corporation Supplier No. H00001340A01

Description

Mouse polyclonal antibody raised against a partial recombinant COX6B1.

Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively. [provided by RefSeq

Sequence: MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI

Specifications

• Antigen: COX6B1
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant COX6B1.
• Formulation: 50% glycerol
• Gene: COX6B1
• Gene Accession No.: NM_001863
• Gene Alias: COX6B/COXG
• Gene Symbols: COX6B1
• Host Species: Mouse
• Immunogen: COX6B1 (NP_001854, 1 a.a. ∼ 86 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1340
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Liquid