COX6B1, Mouse, Clone: 2D3, Abnova™

Catalog No.	Quantity
89-021-140	100 μg

Catalog No. 89-021-140 Supplier Abnova Corporation Supplier No. H00001340M02

Description

Mouse monoclonal antibody raised against a full-length recombinant COX6B1.

Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively. [provided by RefSeq

Sequence: MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI

Specifications

• Antigen: COX6B1
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2D3
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full-length recombinant COX6B1.
• Formulation: PBS with no preservative; pH 7.4
• Gene: COX6B1
• Gene Accession No.: BC001015
• Gene Alias: COX6B/COXG
• Gene Symbols: COX6B1
• Host Species: Mouse
• Immunogen: COX6B1 (AAH01015, 1 a.a. ∼ 86 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1340
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ