Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

COX6B2, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a full-length recombinant COX6B2.

Manufacturer:  Abnova Corporation H00125965A01

Catalog No. 89-003-174


Add to cart

Description

Description

Sequence: MLDVEAQEPPKGKWSTPPFDPRFPSQNQIRNCYQNFLDYHRCLKTRTRRGKSTQPCEYYFRVYHSLCPISWVESWNEQIKNGIFAGKI
Specifications

Specifications

COX6B2
Unconjugated
50% glycerol
NM_144613.4
COXVIB2|MGC119094
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Polyclonal
Human
ELISA, Western Blot
Mouse polyclonal antibody raised against a full-length recombinant COX6B2.
COX6B2
Liquid
COX6B2
COX6B2 (NP_653214, 1 a.a. ~ 88 a.a) full-length recombinant protein with GST tag.
RUO
Primary
125965
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit