COX6C, Mouse, Clone: 4G4-2A8, Abnova™

Catalog No.	Quantity
89-021-141	100 μg

Catalog No. 89-021-141 Supplier Abnova Corporation Supplier No. H00001345M01

Description

Mouse monoclonal antibody raised against a full-length recombinant COX6C.

Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIc, which has 77% amino acid sequence identity with mouse COX subunit VIc. This gene is up-regulated in prostate cancer cells. A pseudogene COX6CP1 has been found on chromosomes 16p12. [provided by RefSeq

Sequence: MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK

Specifications

• Antigen: COX6C
• Applications: ELISA, Immunofluorescence, Immunohistochemistry (PFA fixed), Western Blot
• Classification: Monoclonal
• Clone: 4G4-2A8
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a full length recombinant COX6C.
• Formulation: PBS with no preservative; pH 7.4
• Gene: COX6C
• Gene Accession No.: BC000187
• Gene Symbols: COX6C
• Host Species: Mouse
• Immunogen: COX6C (AAH00187, 1 a.a. ∼ 75 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1345
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ