Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89021145

CPA3, Mouse, Clone: 2D1, Abnova™

Catalog No. 89021145 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-021-145 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-021-145 Supplier Abnova Corporation Supplier No. H00001359M14
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant CPA3.

Three different forms of human pancreatic procarboxypeptidase A have been isolated. This gene encodes a form which is obtained as a binary complex of a procarboxypeptidase A with proproteinase E and functions as a secretory granule metalloexopeptidase. [provided by RefSeq

Sequence: SKLPPNHEDLAKVAKIGTDVLSTRYETRYIYGPIESTIYPISGSSLDWAYDLGIKHTFAFELRDKGKFGFLLPESRIKPTCRETMLAVKFIAKYILKHTS

Specifications

Antigen CPA3
Applications ELISA
Classification Monoclonal
Clone 2D1
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant CPA3.
Formulation PBS with no preservative; pH 7.4
Gene CPA3
Gene Accession No. NM_001870
Gene Symbols CPA3
Host Species Mouse
Immunogen CPA3 (NP_001861, 318 a.a. ∼ 417 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1359
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.