Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

cleavage and polyadenylation specific factor 2, 100kDa, Mouse, Polyclonal Antibody, Abnova™

Mouse polyclonal antibody raised against a partial recombinant CPSF2.

Manufacturer:  Abnova Corporation H00053981A01

Catalog No. 89-004-643


Add to cart

Description

Description

Sequence: FGDDEKETGEESEIIPTLEPLPPHEVPGHQSVFMNEPRLSDFKQVLLREGIQAEFVGGVLVCNNQVAVRRTETGRIGLEGCLCQDFYRIRDLLYEQYAIV
Specifications

Specifications

cleavage and polyadenylation specific factor 2, 100kDa
Unconjugated
50% glycerol
NM_017437
CPSF100|KIAA1367
Mouse
50 uL
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Primary
53981
ELISA, Western Blot
Mouse polyclonal antibody raised against a partial recombinant CPSF2.
CPSF2
Serum
CPSF2
CPSF2 (NP_059133, 683 a.a. ~ 782 a.a) partial recombinant protein with GST tag.
RUO
Y
Polyclonal
Human
Documents
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit