carnitine palmitoyltransferase II, Mouse, Clone: 1G7, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CPT2.

Supplier:  Abnova Corporation H00001376M02

Catalog No. 89-014-079

Description

The protein encoded by this gene is a nuclear protein which is transported to the mitochondrial inner membrane. Together with carnitine palmitoyltransferase I, the encoded protein oxidizes long-chain fatty acids in the mitochondria. Defects in this gene are associated with mitochondrial long-chain fatty-acid (LCFA) oxidation disorders. [provided by RefSeq

Sequence: WFDKSFNLIIAKDGSTAVHFEHSWGDGVAVLRFFNEVFKDSTQTPAVTPQSQPATTDSTVTVQKLNFELTDALKTGITAAKEKFDATMKTLTIDCVQFQR

Specifications

• Antigen: carnitine palmitoyltransferase II
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC005172
• Gene Symbols: CPT2
• Immunogen: CPT2 (AAH05172, 351 a.a. ∼ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody

• Applications: ELISA, Western Blot
• Clone: 1G7
• Description: Mouse monoclonal antibody raised against a partial recombinant CPT2.
• Gene: CPT2
• Gene Alias: CPT1/CPTASE
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1376
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2b κ