Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

carnitine palmitoyltransferase II, Mouse, Polyclonal Antibody, Abnova™

Catalog No. 89004080 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
50 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-004-080 50 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-004-080 Supplier Abnova Corporation Supplier No. H00001376A01
Add to Cart
Add to Cart

Mouse polyclonal antibody raised against a partial recombinant CPT2.

The protein encoded by this gene is a nuclear protein which is transported to the mitochondrial inner membrane. Together with carnitine palmitoyltransferase I, the encoded protein oxidizes long-chain fatty acids in the mitochondria. Defects in this gene are associated with mitochondrial long-chain fatty-acid (LCFA) oxidation disorders. [provided by RefSeq

Sequence: WFDKSFNLIIAKDGSTAVHFEHSWGDGVAVLRFFNEVFKDSTQTPAVTPQSQPATTDSTVTVQKLNFELTDALKTGITAAKEKFDATMKTLTIDCVQFQR

Specifications

Antigen carnitine palmitoyltransferase II
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate Unconjugated
Description Mouse polyclonal antibody raised against a partial recombinant CPT2.
Formulation 50% glycerol
Gene CPT2
Gene Accession No. BC005172
Gene Alias CPT1/CPTASE
Gene Symbols CPT2
Host Species Mouse
Immunogen CPT2 (AAH05172, 351 a.a. ∼ 450 a.a) partial recombinant protein with GST tag.
Quantity 50 μL
Regulatory Status RUO
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 1376
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Form Serum
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.