Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 89021155

CREB1, Mouse, Clone: 2B2, Abnova™

Catalog No. 89021155 Shop All Abnova Corporation Products
missing translation for 'changeView'
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-021-155 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 missing translation for 'options'
Catalog No. 89-021-155 Supplier Abnova Corporation missing translation for 'supplierNo' H00001385M08
Add to Cart
Add to Cart

Description

Mouse monoclonal antibody raised against a partial recombinant CREB1.

This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds as a homodimer to the cAMP-responsive element, an octameric palindrome. The protein is phosphorylated by several protein kinases, and induces transcription of genes in response to hormonal stimulation of the cAMP pathway. Alternate splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq

Sequence: DAAVTEAENQQMTVQAQPQIATLAQVSMPAAHATSSAPTVTLVQLPNGQTVQVHGVIQAAQPSVIQSPQVQTVQSSCKDLKRLFSGTQ

Specifications

Antigen CREB1
Applications ELISA, Western Blot
Classification Monoclonal
Clone 2B2
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant CREB1.
Formulation PBS with no preservative; pH 7.4
Gene CREB1
Gene Accession No. BC010636
Gene Alias CREB/MGC9284
Gene Symbols CREB1
Host Species Mouse
Immunogen CREB1 (AAH10636.1, 14 a.a. ∼ 101 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1385
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Form Liquid
Isotype IgG2a κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.