CREBBP, Mouse, Clone: 2B6, Abnova™

Catalog No.	Quantity
89-123-146	100 μg

Catalog No. 89-123-146 Supplier Abnova Corporation Supplier No. H00001387M02

Description

Mouse monoclonal antibody raised against a partial recombinant CREBBP.

This gene is ubiquitously expressed and is involved in the transcriptional coactivation of many different transcription factors. First isolated as a nuclear protein that binds to cAMP-response element binding protein (CREB), this gene is now known to play critical roles in embryonic development, growth control, and homeostasis by coupling chromatin remodeling to transcription factor recognition. The protein encoded by this gene has intrinsic histone acetyltransferase activity and also acts as a scaffold to stabilize additional protein interactions with the transcription complex. This protein acetylates both histone and nonhistone proteins. This protein shares regions of very high sequence similarity with protein p300 in its bromodomain, cysteine-histidine-rich regions, and histone acetyltransferase domain. Mutations in this gene cause Rubinstein-Taybi syndrome (RTS). Chromosomal translocations involving this gene have been associated with acute myeloid leukemia. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq

Sequence: PVHAQPPGTPLSQAAASIDNRVPTPSSVASAETNSQQPGPDVPVLEMKTETQAEDTEPDPGESKGEPRSEMMEEDLQGASQVKEETDIAEQKSEPMEVDE

Specifications

• Antigen: CREBBP
• Applications: ELISA, Western Blot
• Classification: Monoclonal
• Clone: 2B6
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CREBBP.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CREBBP
• Gene Accession No.: NM_004380
• Gene Alias: CBP/KAT3A/RSTS
• Gene Symbols: CREBBP
• Host Species: Mouse
• Immunogen: CREBBP (NP_004371, 951 a.a. ∼ 1050 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1387
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG1 κ