corticotropin releasing hormone, Mouse, Clone: 2B11, Abnova™

Mouse monoclonal antibody raised against a partial recombinant CRH.

Supplier:  Abnova Corporation H00001392M02

Catalog No. 89-000-588

Description

Corticotropin-releasing hormone (CRH) is a 41-amino acid peptide derived from a 191-amino acid preprohormone. CRH is secreted by the paraventricular nucleus (PVN) of the hypothalamus in response to stress. Marked reduction in CRH has been observed in association with Alzheimer disease and autosomal recessive hypothalamic corticotropin dificiency has multiple and potentially fatal metabolic consequences including hypoglycemia and hepatitis. In addition to production in the hypothalamus, CRH is also synthesized in peripheral tissues, such as T lymphocytes and is highly expressed in the placenta. In the placenta CRH is a marker that determines the length of gestation and the timing of parturition and delivery. A rapid increase in circulating levels of CRH occurs at the onset of parturition, suggesting that, in addition to its metabolic functions, CRH may act as a trigger for parturition. [provided by RefSeq

Sequence: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEIIGK

Specifications

• Antigen: corticotropin releasing hormone
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS with no preservative; pH 7.4
• Gene Accession No.: BC011031
• Gene Symbols: CRH
• Immunogen: CRH (AAH11031, 154 a.a. ∼ 196 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Quantity: 100 μg
• Whole Molecule: Yes
• Gene ID (Entrez): 1392
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Isotype: IgG2a κ

• Applications: ELISA, Western Blot
• Clone: 2B11
• Description: Mouse monoclonal antibody raised against a partial recombinant CRH.
• Gene: CRH
• Gene Alias: CRF
• Host Species: Mouse
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Product Type: Antibody