Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Cdc2-related kinase, arginine/serine-rich, Mouse, Clone: 1H4, Abnova™

Catalog No. 89001288 Shop All Abnova Corporation Products
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
89-001-288 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. 89-001-288 Supplier Abnova Corporation Supplier No. H00051755M01
Add to Cart
Add to Cart

Mouse monoclonal antibody raised against a partial recombinant CRKRS.

Sequence: LVEGDLSSAPQELNPAVTAALLQLLSQPEAEPPGHLPHEHQALRPMEYSTRPRPNRTYGNTDGPETGFSAIDTDERNSGPALTESLVQTLVKNRTFSGSL

Specifications

Antigen Cdc2-related kinase, arginine/serine-rich
Applications ELISA, Immunofluorescence, Western Blot
Classification Monoclonal
Clone 1H4
Conjugate Unconjugated
Description Mouse monoclonal antibody raised against a partial recombinant CRKRS.
Formulation PBS with no preservative; pH 7.4
Gene CRKRS
Gene Accession No. NM_016507
Gene Alias CRK7/CRKR/KIAA0904
Gene Symbols CRKRS
Host Species Mouse
Immunogen CRKRS (NP_057591, 1281 a.a. ∼ 1380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Purification Method Affinity Purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Kinases
Whole Molecule Yes
Primary or Secondary Primary
Gene ID (Entrez) 51755
Target Species Human
Content And Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Product Type Antibody
Isotype IgG1 κ
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.