cisplatin resistance-associated overexpressed protein, Mouse, Polyclonal Antibody, Abnova™

Catalog No.	Quantity
89-004-640	50 μL

Catalog No. 89-004-640 Supplier Abnova Corporation Supplier No. H00051747A01

Description

Mouse polyclonal antibody raised against a partial recombinant CROP.

This gene encodes a protein with an N-terminal half that contains cysteine/histidine motifs and leucine zipper-like repeats, and the C-terminal half is rich in arginine and glutamate residues (RE domain) and arginine and serine residues (RS domain). This protein localizes with a speckled pattern in the nucleus, and could be involved in the formation of splicesome via the RE and RS domains. Two alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq

Sequence: MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALS

Specifications

• Antigen: cisplatin resistance-associated overexpressed protein
• Applications: ELISA, Western Blot
• Classification: Polyclonal
• Conjugate: Unconjugated
• Description: Mouse polyclonal antibody raised against a partial recombinant CROP.
• Formulation: 50% glycerol
• Gene: CROP
• Gene Accession No.: NM_006107
• Gene Alias: LUC7A/OA48-18
• Gene Symbols: CROP
• Host Species: Mouse
• Immunogen: CROP (NP_006098, 1 a.a. ∼ 110 a.a) partial recombinant protein with GST tag.
• Quantity: 50 μL
• Regulatory Status: RUO
• Research Discipline: Apoptosis
• Whole Molecule: Yes
• Primary or Secondary: Primary
• Gene ID (Entrez): 51747
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Form: Serum