CRYBA2, Mouse, Clone: 2G9, Abnova™

Catalog No.	Quantity
89-021-171	100 μg

Catalog No. 89-021-171 Supplier Abnova Corporation Supplier No. H00001412M04

Description

Mouse monoclonal antibody raised against a partial recombinant CRYBA2.

Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of the vertebrate eye, which function to maintain the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also defined as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Beta-crystallins, the most heterogeneous, differ by the presence of the C-terminal extension (present in the basic group but absent in the acidic group). Beta-crystallins form aggregates of different sizes and are able to form homodimers through self-association or heterodimers with other beta-crystallins. This gene is a beta acidic group member. Three alternatively spliced transcript variants encoding identical proteins have been reported. [provided by RefSeq

Sequence: SFRPVLCANHNDSRVTLFEGDNFQGCKFDLVDDYPSLPSMGWASKDVGSLKVSSGAWVAYQYPGYRGYQYVLERDRHSGEFCTYGELGTQAHTGQLQSIR

Specifications

• Antigen: CRYBA2
• Applications: ELISA
• Classification: Monoclonal
• Clone: 2G9
• Conjugate: Unconjugated
• Description: Mouse monoclonal antibody raised against a partial recombinant CRYBA2.
• Formulation: PBS with no preservative; pH 7.4
• Gene: CRYBA2
• Gene Accession No.: NM_005209
• Gene Symbols: CRYBA2
• Host Species: Mouse
• Immunogen: CRYBA2 (NP_005200.1, 94 a.a. ∼ 193 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Purification Method: Affinity chromatography
• Quantity: 100 μg
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1412
• Target Species: Human
• Content And Storage: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
• Product Type: Antibody
• Form: Liquid
• Isotype: IgG2a κ